PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010917240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NF-YA
Protein Properties Length: 341aa    MW: 37103.3 Da    PI: 9.6105
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010917240.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.71.7e-32184240158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     dep+YVNaKQy++Il+RRq Rakle+++k+ +++rkpylheSRh hA++R+RgsgGrF
  XP_010917240.1 184 DEPIYVNAKQYHGILRRRQLRAKLEAQNKV-IRGRKPYLHESRHIHAMKRARGSGGRF 240
                     79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.3E-37182243IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.337183243IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.8E-28185240IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.0E-24186208IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860188208IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.0E-24217240IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MQNLSNKDSE QSSVHSTANC LINCPSWWNY SGPNMLQSSY SKNLYMNMGT MAQQSNQTKQ  60
PVLQMPDQDS SSTQSTGQSH QELGATMERN LHEQGALAHS GDNVTSRKQV EDHMKPVLSL  120
GTAGAVLQPQ KIDFSQSIAC IPYPYADPYF GGIVATYGSH AVIHPQLAGM APSARVPLPQ  180
PVEDEPIYVN AKQYHGILRR RQLRAKLEAQ NKVIRGRKPY LHESRHIHAM KRARGSGGRF  240
LNTKQLQQHS QTATTNDKKN ASSSSLLQLG GGEGTENGTM SSAATPTGSE VSAVSDGSLF  300
QHQDHHLNFS TNFHPRVVGG SMQGGSSGIH SGSQQRVSVM R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A6e-20184245263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010917240.10.0PREDICTED: nuclear transcription factor Y subunit A-4-like
RefseqXP_010917241.10.0PREDICTED: nuclear transcription factor Y subunit A-4-like
RefseqXP_010917242.10.0PREDICTED: nuclear transcription factor Y subunit A-4-like
TrEMBLM0TR232e-87M0TR23_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P16700_0016e-87(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.12e-46nuclear factor Y, subunit A3